SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_03191 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_03191
Domain Number 1 Region: 230-377
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-29
Family Dual specificity phosphatase-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_03191
Sequence length 489
Comment | SCRG_03190 | Saccharomyces cerevisiae RM11-1a protein tyrosine phosphatase (490 aa)
Sequence
MQFHSDKQHLDSKTDIDFKPNSPRSLQNRNTKNLSLDIAALHPLMEFSSPSQDVPGSVKF
PSPTPLNLFMKPKPIVLEKCPPKVSPRPTPPSLSMRRSEASIYTLPTSLKNRTVSPSVYT
KSSTVSSISKLSSSSPLSSFSEKPHLNRVHSLSVKTKDLKLKGIRGRSQTISGLETSTPI
SSTREGTLDSTDVNRFSNQKNMQTTLIFPEEDSDLNIDMVHAEIYQRTVYLDGPLLVLPP
NLYLYSEPKLEDILSFDLVINVAKEIPNLEFLIPPEMAHKIKYYHIEWTHTSKIVKDLSR
LTRIIHTAHSQGKKILVHCQCGVSRSASLIVAYIMRYYGLSLNDAYNKLKGVAKDISPNM
GLIFQLMEWGTMLSKNSPGEEGETVHMPEEDDIGNNEVSSTTKSYSSASFRSFPMVTNLS
SSPNDSSVNSSEVTPRTPATLTGARTALATERGEDDEHCKSLSQPADSLEASVDNESIST
APEQMMFLP
Download sequence
Identical sequences A0A0L8VIN8 B3LNR4 B5VQY9 C7GLU8 C8ZGH5 E7KTM0 E7QK15 H0GMN3 N1NXK7 P38590
YNL053W SCRT_03191 YNL053W YNL053W YNL053W YNL053W 4932.YNL053W NP_014345.3.97178 YNL053W YNL053W YNL053W YNL053W YNL053W YNL053W YNL053W YNL053W GO.34670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]