SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_03194 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_03194
Domain Number 1 Region: 4-150
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.56e-27
Family Dual specificity phosphatase-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_03194
Sequence length 197
Comment | SCRG_03193 | Saccharomyces cerevisiae RM11-1a hypothetical protein similar to Ynl2439p (198 aa)
Sequence
MKYIPPLNFSPVVSTDVSLYRSGYPMPLNYSFIKHQLHLKTIIYIGDKDRPLEEYQSFLE
SEKIKYYHIFMDSSRDEGIQERMNQVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLL
QGWSTAGIYQEYGLFSGGMKDGVDLEFITMFETNLKIPRNVIPGFAKHCLYLNELEAAEG
SDDESGSESILTAKQPI
Download sequence
Identical sequences A6ZS22 B3LNR7 B5VQY6 C7GLU5 C8ZGH2 E7LZL0 G2WM47
YNL056W YNL056W YNL056W YNL056W tr|A6ZS22|A6ZS22_YEAS7 YNL056W YNL056W YNL056W YNL056W YNL056W YNL056W YNL056W YNL056W SCRT_03194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]