SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_03236 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_03236
Domain Number 1 Region: 67-202
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.1e-27
Family Dual specificity phosphatase-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_03236
Sequence length 238
Comment | SCRG_03235 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (239 aa)
Sequence
MTSKVGEYEDVPEDESRLTEENVSVPEEEVEDEDEEEDDDDDHIYINEETESGREKVLVS
HAPQERIVPPLNFCPVERYLYRSGQPSPVNFPFLLNLKLKTIIWLSNEEPQDTLLEFCDT
HRINLQFAAINPDAGEDDNPWDGLTEHSIINVLQTIVTQENYPLLVCCGMGRHRTGTVIG
CLRRIMGWNLASVSEEYRRFTGSRGGRILVELLIEAFDTNLVKIDKNKAPSWLLTALE
Download sequence
Identical sequences A0A0L8VIW7 A0A250WGT1 A6ZRY1 B3LNV8 B5VQU3 C7GR79 C8ZGD0 E7KH47 E7LZJ9 E7NMA4 E7Q8K8 G2WM05 H0GMJ7 N1NZE8 P50946
SCRT_03236 YNL099C sp|A6ZRY1|OCA1_YEAS7 YNL099C YNL099C YNL099C YNL099C NP_014300.3.97178 YNL099C YNL099C YNL099C YNL099C YNL099C YNL099C YNL099C YNL099C YNL099C YNL099C YNL099C 4932.YNL099C YNL099C YNL099C YNL099C YT174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]