SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_03262 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_03262
Domain Number 1 Region: 42-94,143-251
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.31e-27
Family Dual specificity phosphatase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_03262
Sequence length 434
Comment | SCRG_03261 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (435 aa)
Sequence
MREEGSELEMEKGFLKWKPVNLMKKILSLPMKKTKNDIGLRLDISYILVNLIVCSYPVNT
YPKLLYRNSLDDLILFLTVYHGKGNFRIFNFRGEKEDSDYKDNDLIGIAAKFESKDFEIQ
ELRSTLINDGKIPISPIDLETRTLVEEETNNVICERIGWLDHFPPPFELLEEIVDGIENH
LSVSKNRVAVLHCRMGKGRSGMITVAYLMKYLQCPLGEARLIFMQARFKYGMTNGVTIPS
QLRYLRYHEFFITHEKAAQEGISNEAVKFKFKFRLAKMTFLRPSSLITSESAIVTTKIQH
YNDDRNALLTRKVVYSDIMAHECGGNMTFIFGRDYLTLENDCRIEFTLGTSKSKAASSII
SWTSCASCWLNIYLETLMHIIKDDSSPDYFQVERLKRDEMLGTTISWQELDGFGELSTHG
LKLFQALKLEWEII
Download sequence
Identical sequences B3LNY4
SCRT_03262 YNL128W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]