SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_03278 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  SCRT_03278
Domain Number - Region: 239-315
Classification Level Classification E-value
Superfamily PH domain-like 0.000414
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number - Region: 534-581
Classification Level Classification E-value
Superfamily ARM repeat 0.0633
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_03278
Sequence length 740
Comment | SCRG_03277 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (741 aa)
Sequence
MSSSIFEMTIDHDGMDSTGLKLSQTASSISMGDEFLCSSTTSNSILDSPLPKVTFNHIDS
ITDINTNIMNEIVEPQSGVDVDVADKNVLYCIDPYPVEPPCYDFANPSKVIRYPIYEHCR
PCLTSVKPPSYTPSVEHYTVVSMKMEKLSPFENASSRLWNNFILQINSTQINFYSIDDSL
TRHIKNYRGGDMFDHPHHSKTASDRHHSARSLLNAFTTKSTYQFDKYDKERICGEIARDE
HKFLSDERLFKSYSLQCAKVGLPIDYSSRDFVLRMRCEGQQFLVQFSHVDELIYWAMYLN
MGISLSLDLELREMPTYRSVPRRRHPRARRFKQHNKNKNKNKSRQNSDRNDSRSHSLLLR
RSHTSSVVTKVATGNERPTNKSRSRSLSLLPPSVSDASHDSNGPNDSGSLAGESSQTDFC
GLFTSKLRNFFKTDSSSRKNSNMDIGQKMRSKELNSVQEEIDDNGSTTNTNTSVLSSTFS
PTAHSVLTAQTSIHENFRSRSNSNPIDPLRCDRSVLKINNFEPVYEGTGRSTISNSAERT
NREEKLNRGNEDVNGDEDDDEDEDDANYEEDDEDGYVEDDDINRLVYLDERESRYENADV
EYGTIFSTKSFSVTGCLNHDFPKKLSLKCGNKNQSSNDSKWAPATQLVSRKRYIKDSLRC
IKPLTEDHPWVGKIIFKPALPPAFETNNPPIRVYSGEDSTDLMHVKNHYLKPYIVGSCGF
LKTGSKLFHFYDRTNDLTNL
Download sequence
Identical sequences B3LNZ9
YNL144C SCRT_03278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]