SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_03424 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_03424
Domain Number 1 Region: 543-828
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-76
Family Protein kinases, catalytic subunit 0.0000000812
Further Details:      
 
Domain Number 2 Region: 64-175
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-16
Family Pleckstrin-homology domain (PH domain) 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_03424
Sequence length 842
Comment | SCRG_03423 | Saccharomyces cerevisiae RM11-1a serine/threonine-protein kinase CLA4 (843 aa)
Sequence
MSLSAAANKISDNDFQNIGPAPRPPSSNSQGRTCYNQTQPITKLMSQLDLTSASHLGTST
SKKKSGWVSYKDDGILSFIWQKRYLMLHDSYVALYKNDKQNDDAILKIPLTSIISVSRTQ
LKQYCFELVRCSDRNSVSSGSSSSLNVSSDSNSKKSIYIATKTESDLHSWLDAIFAKCPL
LSGVSSPTNFTHKVHVGFDPETGSFVGMPTNWEKLLKHSRITGEDWNNNSAAVIQVLQFY
QEYNGAGNPTNTLDKPQSGETSSSQKSLPNSYNDNKLRNNSVNSMSSSGVSSSMVSQRKT
SQPPNTKSPVSLGSGSLPPINTKLPTSQSNIPRHLQNVPNQQYPKMRNGHSPTNGQFPRG
PMHPNNSQRSLQQQQQQQQQQKQQHQQYPYHHQGPSPSPSPSPSPLNPYRPHHNMINPYS
KQPQSPLSSQSTQNQAIPRYAQNSSPTAAHFQPQRTAPKPPISAPRAPYPSNQNATSNTH
VQPVAPKNDQSTPQTMRQAPKRPDADVAQPGGVAKPKKPARPTMSTAEIMSKLKKVTVNA
DPSQCFKVIEKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSK
QPRKELIVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDN
SHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTD
KRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLI
ATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFFNMACDPKDLTSLLEW
KE
Download sequence
Identical sequences B3LPD4
YNL298W YNL298W SCRT_03424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]