SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_04143 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_04143
Domain Number 1 Region: 305-509
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.68e-34
Family Ankyrin repeat 0.00000000193
Further Details:      
 
Weak hits

Sequence:  SCRT_04143
Domain Number - Region: 555-633
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0602
Family Apolipoprotein A-I 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_04143
Sequence length 803
Comment | SCRG_04142 | Saccharomyces cerevisiae RM11-1a regulatory protein SWI6 (804 aa)
Sequence
MALEEVVRYLGPHNEIPLTLTRDSETGHFLLKHFLPILQQYHDTGNINETNPDSFPTDEE
RNKLLAHYGIAVNTDDRGELWIELEKCLQLLNMLNLFGLFQDAFEFEEPETDQDEEDPSH
SKLPENKTKSENSKDNISSKRINNLQDMSLDSDAHRELGSPLKKLKIDTSVIDAESDSTP
NTARGKPNDDINKGPSGDNENNGTDDSDRTAGPIITFTHDLTSDFLSSPLKIMKALPSPV
VNDNEQKMKLEAFLQRLLFPEIQEMPTSLNNDSSNRNSEGGSSNQQQQHVSFDSLLQEVN
DAFPNTQLNLNIPVDEHGNTPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKAVK
SVNNYDSGTFEALLDYLYPCLILEDSMNRTILHHIIITSGMTGCSAAAKYYLDILMGWIV
KKQNRPIQSGTNEKESKPNDKNGERKDSILENLDLKWIIANMLNAQDSNGDTCLNIAARL
GNISIVDALLDYGADPFVANKSGLRPVDFGAGTSKLQNTNGGDENSKMVSKGDYDGQKNG
KAKKIRSQLLKNPPETTSLINDVQNLLNSISKDYESETVQYNEKLEKLHKELNEQREELA
NSREQLANVKQLKDEYSLMQEQLTNLKAGIEEEEESFREESKKLGIIADESSGIDWDSSE
YDADEPFKVEFLSDFLEDKLQKNYEGDISKLLEAESKEQIMEQIRNQIPAEKIQSMLPPT
VLLKARINAYKRNDKHLTNVLDTISTKQSELENKFRRVLSLCLKIDENKVDNMLDGLLQA
ISSEDPQDIDTDEMQDFLKKHAS
Download sequence
Identical sequences B3RH74
YLR182W SCRT_04143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]