SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_04149 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_04149
Domain Number 1 Region: 740-1161
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 7.85e-102
Family Gtf glycosyltransferase 0.0008
Further Details:      
 
Domain Number 2 Region: 232-360
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-17
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_04149
Sequence length 1198
Comment | SCRG_04148 | Saccharomyces cerevisiae RM11-1a UDP-glucose:sterol glucosyltransferase (1199 aa)
Sequence
MPITQIISASDSEAGPKPSISLVPDKPSEPETSPRHHRLSRSLSKFKRWRGRSNSSLSMG
SSEQQELQDSPNEARSDDDENGYNNDNADDLAKSKYMMKSIAGLLTTASVYAGMNNAQEM
NVLSQVDSEESDSSDSFQENIGRNEVKSKKENLKTKSHPEVPRLDKRKPTLFDFSITREK
LSKDNVAKLRQRFCLDEREPFLNDFPAWLLKDVLVQGHIFITTKHFLFFAYLPKNPRSVK
MSGNLNIRTKLIRSTRYWCVLKNHLFSMYTSSTELYFPVLTIDLREVQKIETQKHTLNGS
ATKTFKLYTDESTFKFNADSEFSAKSWVNALKKEQFAAQNSENNSISLKIPLPNIIEIDD
QPIVNKALTLRLRALESSQTYAIDDFMFVFMDGSGSQVKESLGEQLAILQKSGVNTLYYD
IPAKKSKSSFGKETPATAEQKNNGEDSKYLNVPTSAVPSSENGKKSRFRFRERSNSWFRR
AKPLEDSQVEDVEEIYKDAANDIDSSVHSTIHIHEQEDSQEQTVAWKPSHLKNFAEMWAA
KPIHYRNKFIPFQKDDTYLIKETEEVSANERFRYHFKFNKEKSLISTYYTYLNRNVPVYG
KIYVSNDTVCFRSLLPGSNTYMVLPLVDVETCYKEKGFRFGYFVLVIVIHGHEELFFEFS
TEVARDDIERILLKLLDNIYASSAEGSNISSASLGDVQHNPDSAKLKLFEDKINAEGFEV
PLMIDENPHYKTSIKPNKSYKFGLLTIGSRGDVQPYIALGKGLIKEGHQVVIITHSEFRD
FVESHGIQFEEIAGNPVELMSLMVENESMNVKMLREASSKFRGWIDALLQTSWEVCNRRK
FDILIESPSAMVGIHITEALQIPYFRAFTMPWTRTRAYPHAFIVPDQKRGGNYNYLTHVL
FENVFWKGISGQVNKWRVETLGLGKTNLFLLQQNNVPFLYNVSPTIFPPSIDFSEWVRVT
GYWFLDDKSTFKPPAELQEFISEARSKGKKLVYIGFGSIVVSNAKEMTEALVEAVMEADV
YCILNKGWSERLGDKAAKKTEVDLPRNILNIGNVPHDWLFPQVDAAVHHGGSGTTGASLR
AGLPTVIKPFFGDQFFYAGRVEDIGVGIALKKLNAQTLADALKVATTNKIMKDRAGLIKK
KISKEDGIKTAISAIYNELEYARSVTLSRVKTPRKKEENVDATKLTPAETTDEGWTMI
Download sequence
Identical sequences A0A0L8VLS4 B3RH80 B5VNA8 C7GIX6
YLR189C YLR189C SCRT_04149 YLR189C YLR189C YLR189C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]