SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_04365 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_04365
Domain Number 1 Region: 447-675
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.6e-26
Family DBL homology domain (DH-domain) 0.0015
Further Details:      
 
Domain Number 2 Region: 710-772,834-890
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000899
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_04365
Sequence length 1307
Comment | SCRG_04364 | Saccharomyces cerevisiae RM11-1a Rho1 guanine nucleotide exchange factor TUS1 (1308 aa)
Sequence
MYRYNRSSPFERTPEKRVSRQESQRKSIELPKLPPLNTRNSFLDDSDNGTDNISIGWTPI
SDTQQFQSPVPQAFTFTSKHSARGNGTSSSESTPKSTKYVKERRPPPPPPLLYSTESIRI
DSPMVSPSSQSRERSPNKLSFIGNSEERHHMEYISNHSRILKSPFANGFSPNSPKSPRDS
SKQQAHFSDESDLRCHEREKALPPIPFTTTLLLSPFDDEDSEFFTKPPPPLSTSRNVSGN
SRVSEALESVYSDSDYTFNNSNARQSSFNSLLGAKPLELAPSITAPTQPFSIQSIDEHKL
YQCDNVYKLSAIYEWILKVYFEWFNECVFTKIDLFQIVQLLLEFQMPTNFDQDTIDSNVD
NIMASFISQKAVRFDIINDEEVAVVVGGLDITGVFTELLPCYSFIDNTYGSTNSLICYSN
VCTHGQSSGFRKEIKLSEIINKSVGLWTEYWHLTPDDLAEINPREVQRQSFIFDLIILEE
RSLNMATAAVEIYGKRFDKSLLPDEPEFKALAFDIFEPLIQLHTEFLLTPIFWKLKTRGK
FIDGVGKIYSKWCGEAKNIYLNYAKAMATVHEIIMWEKKNKTKFVTWLKEIDNSVEITRS
KMYHDVIFFGGFFKSLQNMPVTLRSILKNTDPSMEDYEYLKIVIKEVEKLNFEVNQVHGL
AIDHRKLVRFSKQLVLSTNSSNATSYVNVGGSTNANDDDAIQDKLALGLTYPERKLVLSG
TVYKKRDLWLDPTPVYIALLDNCLLITEEISKGETQKYKLIERPIPIDYLSLEKRKIPGT
SKQPLRNYSQKEHKSPMHNFSTPINSMRPLLKSSGNHMSTAYGDRKTSNTEISNANPNTD
EFSFKIRNTATGESFKFFTESAEVLNQWIDAIMESFKRNAENHDLNAFEFTVLSSEFAYF
DKDAPVNLPVAPEGSEIDVALKAYAQKANKDSCSWSKTTRILCCEDVKFEGRIYLFVATT
DGIYVKYRDDYGSGFVKILELNDVKRMEANVKLGLLFVLDNRKLCYFNISTVVSRYLAQG
NTLDENCIVGTVIRDKVRFFKIADDFGNSKHLFFERKGKIVILTPEFDQLTNQVKYFKFY
KEYKLPSSSNNILNNEIEDIAIFRKSFAVCTKKTVILYQDSFEDNGIVLPSFLNDKDMMA
HLRHPHLNSLPFKSATDSKKRPSIESLTEEAKKDIATCKAIPVNFFQISQSRFFALVYDE
AVVKINCYGEMSDWRKDILLLDFCCTGASFHGNHLILVGDNLIQIYDLKNVEQSLGELVP
VQIIKGKKIKLASSERREKTILVLSHPNILNRQLLVACNPVAMADHQ
Download sequence
Identical sequences B3RHT5
YLR425W SCRT_04365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]