SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_04588 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_04588
Domain Number 1 Region: 36-157
Classification Level Classification E-value
Superfamily DNA-binding domain of Mlu1-box binding protein MBP1 3.92e-36
Family DNA-binding domain of Mlu1-box binding protein MBP1 0.000082
Further Details:      
 
Domain Number 2 Region: 478-680
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.84e-21
Family Ankyrin repeat 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_04588
Sequence length 1093
Comment | SCRG_04587 | Saccharomyces cerevisiae RM11-1a regulatory protein SWI4 (1094 aa)
Sequence
MPFDVLISNQKDNTNHQNITPISKSVLLAPHSNHPVIEIATYSETDVYECYIRGFETKIV
MRRTKDDWINITQVFKIAQFSKTKRTKILEKESNDMQHEKVQGGYGRFQGTWIPLDSAKF
LVNKYEIIDPVVNSILTFQFDPNNPPPKRSKNSILRKTSPGTKITSPSSYNKTPRKKNSS
SSTSATTTAANKKGKKNASINQPNPSPLQNLVFQTPQQFQVNSSMNIMNNNDNHTTMNFN
NDTRHNLINNISNNSNQSTIIQQQKSIHENSFNNNYSATQKPLQFFPIPTNLQNKNVALN
NPNNNDSNSYSHNIDNVINSSNNNNNGNNNNLIIVPDGPMQSQQQQQHHHEYLTNNFNHS
MMDSITNGNSKKRRKKLNQSNEQQFYNQQEKIQRHFKLMKQPLLWQSFQNPNDHHNEYCD
SNGSNNNNNTVASNGSSIEVFSSNENDNSMNMSSRSMTPFSAGNTSSQNKLENKMTDQEY
KQTILTILSSERSSDVDQALLATLYPAPKNFNINFEIDDQGHTPLHWATAMANIPLIKML
ITLNANALQCNKLGFNCITKSIFYNNCYKENAFGEIISILKICLITPDVNGRLPFHYLIE
LSVNKSKNPMIIKSYMDSIILSLGQQDYNLLKICLNYQDNIGNTPLHLSALNLNFEVYNR
LVYLGASTDILNLDNESPASIMNKFNTPAGGSNSRNNNTKADRKLARNLPQKNYYQQQQQ
QQQPQNNVKIPKIIKTQHPDKEDSTADVNIAKTDSEVNESQYLHSNQPNSTNMNTIMDDL
SNINSFVTSSVIKDIKSTPSKILENSPILYRRRSQSISDEKEKAKDNENQVEKKKDPLNS
VKTAMPSLESPSSLLPIQMSPLGKYSKPLSQQINKLNTKVSSLQRIMGEEIKNLDNEVVE
TESSISNNKKRLITIAHQIEDAFDSVSNKTPINSISDLQSRIKETSSKLNSEKQNFIQSL
EKSQALKLATIVQDEESKVDMNTNSSSHPEKQEDEEPIPKSTSETSSPKNTKADAKFSNT
VQESYDVNETLRLATELTILQFKRRMTTLKISEAKSKINSSVKLDKYRNLIGITIENIDS
KLDDIEKDLRANA
Download sequence
Identical sequences B3LRM7
SCRT_04588 YER111C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]