SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_04868 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_04868
Domain Number 1 Region: 311-421
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000616
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 
Domain Number 2 Region: 13-271,306-335
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000126
Family BAR domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_04868
Sequence length 1228
Comment | SCRG_04867 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (1229 aa)
Sequence
MHEHKAELRLITVALNEASTDSPSFRASVNYFHTRMESLSSWMHSTVDYVENTYKPSFQD
FQRIKEILFSQLLPSPILLSNGFVSNQPYTPLLVRDFTRDVSDLSNTVMKIILGDENSQY
TAALSALSSDAINPYFNKRKTFEYYQRKYDSFLTDFLAATNDGNTLIPQNLQNETFKLFD
IKHKYIEASLDLTEAISLMKVNLDKFLIETIDIVRKNNVITTKDTKDVIDITPELTETLK
DWTDWIESNLQTLQALSSKLSEAKYAILKLSLARMKPSRLIQDYDLKSIQNLKFNLPKSI
SNGNNSEEKGLSGWLYMKTTVGHDPKRVVWVRRWCFLQNNVFGVFSLSPSKTYVEETDKF
GILWITVEYLPKEPRNFCFKLRIQNPNCKTEEENTYIDIILQAESIDELKSWINTLTSHK
RIALSIKEENDPRYQLARKKIEPQFFEFASSSSTSTDKLLTSFSSKTLTLVEELKKNYMS
EDDIYSIIDNKAYHLRVISTPIATQLTHLALFSTFLSVSNYYPCATQANTWGTANWNDLS
YLVNPLKGSSVHKPATVSNSSRFSVSYPDYYPYSLKVDDIQFRSIFFSVNHDFLQVPKEL
VLLRYSSVWCPNNKQKFASMAFVTLNHIYVYLNISGFSYLRRIDLLDIDSIEYDKSPKHV
SSRMLHMQRGDGLRFNMSVFFTDRRAVASKLQFLIENKAMHIPKGEKDVLEIFQELDEEI
ENEKKIIKDNLSESEHYSKDYDYLLKSTYDHHFENTNETPMELMSRKVRLEREAWCYFQD
NFKVGSKTLFHVLFGDKSQVFPSSLFLCKKGSNLNNNSYWERIRRAKEDASCQFELCRKL
QFQLNRTSNFIKDLLWLKDDNDNFKLVLQQRVTKIKQGYYFEVEEGPIIVKFPLCHPLLL
RVRFIIAECITSQGESLKKCDLAILYDFNYVESIDKLNTKVEKLWLFERIHLNWALRYCK
LEHSEINRKTREYLKKFNDREKMSDVIKLCGFLGVLPKERIENDEKAGDFMQPVYINYDF
LSLSKIFTKLTVFYLSSVIIKTMKVLLAMVMVIFKCFSKVNKTLYYCLLISAVTNLFFVG
KSIHSYFSVKSAETLFQNYANGDQRGLQIMHRSLTVPDLNLLTRKMMDNDQENPVFKRFD
EDKNAYQYKGTRQEIAIKRNQVLTELKILQNTEKELVQGSYRKFIITERDKCITTQNEIF
DLWINDTKLQDYCMACFAEYNRLSAIPV
Download sequence
Identical sequences B3LSR9
YHR155W YHR155W SCRT_04868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]