SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_05153 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_05153
Domain Number 1 Region: 11-170
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.16e-35
Family Dual specificity phosphatase-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_05153
Sequence length 364
Comment | SCRG_05152 | Saccharomyces cerevisiae RM11-1a tyrosine-protein phosphatase YVH1 (365 aa)
Sequence
MAGNANSADEEVTRILGGIYLGGIRPIIDHRPLGAEFNITHILSVIKFQVIPEYLIRKGY
TLKNIPIDDDDVTDVLQYFDETNRFIDQCLFPNEVEYSPRLVDFKKKPQRGAVFAHCQAG
LSRSVTFIVAYLMYRYGLSLSMAMHAVKRKKPSVEPNENFMEQLHLFEKMGGDFVDFDNP
AYKQWKLKQSIKLDPSGSELVSNSGMFKDSESSQDLDKLTEAEKSKVTAVRCKKCRTKLA
LSTSFIAHDPPSKESSEGHFIKRAANSHRIIDIQESQENCSHFFIEPLKWMQPELQGKQE
LEGKFSCPGCSSKVGGYNWKGSRCSCGKWVIPAIHLQTSKVDQFPLQSTALPNMVNFESE
KVNR
Download sequence
Identical sequences B3LTI3
YIR026C SCRT_05153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]