SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_05285 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_05285
Domain Number 1 Region: 324-435,537-635
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-51
Family Ankyrin repeat 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_05285
Sequence length 1083
Comment | SCRG_05284 | Saccharomyces cerevisiae RM11-1a protein HOS4 (1084 aa)
Sequence
MNETTTKQPLKKRSLSSYLSNVSTRREELEKISKQETSEEEDTAGRHEQRETLSEEVSDK
FPENGASFRSQTTSVHQATQNNLNAKESEDLAHKNDASSHEGEVNGDSRPDDVPETNEKI
SQAIRAKISSSSSSPNVRNVDIQNHQPFSRDQLRAMLKEPKRKTVDDFIEEEGLGAVEEE
DLSDEVLEKNTTEPENVEKDIEYSDSDKDTDDVGSDDPTAPNSPIKLGRRKLVRGDQLDA
TTSSMFNNESDSELSDIDDSKNIALSSSLFRGGSSPVKETNNNLSNMNSSPAQNPKRGSV
SRSNDSNKSSHIAVSKRPKQKKGIYRDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQ
DNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLK
NGADPTIRNAKGLTAFESVDDESEFDDEEDQKILREIKKRLSIAAKKWTNRAGIHNDKSK
NGNNAHTIDQPPFDNTTKAKNEKAADSPSMASNIDEKAPEEEFYWTDVTSRAGKEKLFKA
SKEGHLPYVGTYVENGGKIDLRSFFESVKCGHEDITSIFLAFGFPVNQTSRDNKTSALMV
AVGRGHLGTVKLLLEAGADPTKRDKKGRTALYYAKNSIMGITNSEEIQLIENAINNYLKK
HSEDNNDDDDDDDNNNETYKHEKKREKTQSPILASRRSATPRIEDEEDDTGMLNLADDDF
NNDRDVKESTTSDSRKRLDDNENVGTQYSLDWKKRKTNALQDEEKLKSISPLSMEPHSPK
KAKSVEISKIHEETAAEREARLKEEEEYRKKRLEKKRKKEQELLQKLAEDEKKKIEEQEK
QKVLEMERLEKATLEKARKMEREKEMEEISYRRAVRDLYPLGLKIINFNDKLDYKRFLPL
YYFVDEKNDKFVLDLQVMILLKDIDLLSKDNQPTSEKIPVDPSHLAPLWNMLKFIFLYGG
SYDDKKNNMENKRYVVNFDGVDLDTKIGYELLEYKKFVSLPMAWIKWDNVVIENHAKRKE
IEGNMIQISINEFARWRNDKLNKAQQPTRKQRSLKIPRELPVKFQHRMSISSVLQQTSKE
PFW
Download sequence
Identical sequences B3LTV9
YIL112W YIL112W SCRT_05285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]