SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_05286 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_05286
Domain Number 1 Region: 41-197
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.35e-26
Family Dual specificity phosphatase-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_05286
Sequence length 209
Comment | SCRG_05285 | Saccharomyces cerevisiae RM11-1a hypothetical protein similar to stress-inducible dual-specificity MAP kinase phosphatase (210 aa)
Sequence
MNIYTSPTRTPNIVPKSGQRPSLPMLATDERSTDKESPNEDREFVPCSSLDVRRIYPKGP
LLVLPEKIYLYSEPTVKELLPFDVVINVAEEANDLRMQVPAVEYHHYRWEHDSQIALDLP
SLTSIIHAATTKREKILIHCQCGLSRSATLIIAYIMKYHNLSLRHSYDLLKSRADKINPS
IGLIFQLMEWEVALNAKTNVQANSYRKVP
Download sequence
Identical sequences B3LTW0 B5VKJ7 C7GKN8 E7KDT8 E7LVM3 E7QG08
YIL113W YIL113W YIL113W YIL113W YIL113W YIL113W YIL113W YIL113W YIL113W YIL113W YIL113W SCRT_05286 YIL113W YIL113W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]