SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_05390 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_05390
Domain Number 1 Region: 260-439
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000222
Family DBL homology domain (DH-domain) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_05390
Sequence length 1636
Comment | SCRG_05389 | Saccharomyces cerevisiae RM11-1a bud site selection protein BUD3 (1637 aa)
Sequence
MEKDLSSLYSEKKDKENDETLFNIKLSKSVVETTPLNGHSLFDDDKSLSDWTDNVFTQSV
FYHGSDDLIWGKFFVCVYKSPNSNKLNAIIFDKLGTSCFESVDISSNSQYYPAIENLSPS
DQESNVKKCIAVILLQRYPLLSPSDLSQILSNKSENCDYDPPYAGDLASSCQLITAVPPE
DLGKRFFTSGLLQNRFVSSTLLDVIYENNESTIELNNRLVFHLGEQLEQLFNPVTEYSPE
QTEYGYKAPEDELPTESDDDLVKAICNELLQLQTNFTFNLVEFLQKFLIALRVRVLNEEI
NGLSTTKLNRLFPPTIDEVTRINCIFLDSLKTAIPYGSLEVLKACSITIPYFYKAYTRHE
AATKNFSKDIKLFIRHFSNVIPEREVYTEMKIESIIKGPQEKLLKLKLIIERLWKSKKWR
PKNQEMAKKCYNNIIDVIDSFGKLDSPLHSYSTRVFTPSGKILTELAKCWPVELQYKWLK
RRVVGVYDVVDLNDENKRNLLVIFSDYVVFINILEAESYYTSDGSNRPLISDILMNSLIN
EVPLPSKIPKLKVERHCYIDEVLVSILDKSTLRFDRLKGKDSFSMVCKLSSAFISSSSVA
DLITKARILEKDTAFHLFKASRSHFTLYSTAHELCAYDSEKIKSKFALFLNIPPSKEILE
VNNLHLAFFARFCSNDGRDNIVILDVLTKHDDKHIEVTSDNIVFTIINQLAIEIPICFSS
LNSSMAKDLLCVNENLIKNLEHQLEEVKHPSRDEHRAVNSKLSGASDFDATHEKKRSYGT
ITTFRSYTSDLKDSPSGDNSNVTKETKEILPVKPTKKSSKKPREIQKKTKTNASKAEHIE
KKKPNKGKGFFGVLKNVFGSKSKSKPSPVQRVPKKISQRHPKSPVKKPMTSEKKSSPKRA
VVSSPKIKKKSTSFSTKESQTAKSSLRAVEFKSDDLIGKPPDVGNGAHPQENTRISSVVR
DTKYVSYNPSQHVTENASNEKNVEPKADQSTKQDNISNFADVEVSASSYPEKLDAETDDQ
IIGKATNSSSVHGNKELSDLAEVTTANRVSTTSAGDQRIDTQSEFLRAADVENLSDDDEH
RQNESRVFNDDLFGDFIPKHYRNKQENINSSSNLFPEGKVPQEKGVSNENTNISLKTNED
ASTLTQKLSPQASKVLTENSNELKDTNNEGKDAKDIKLGDDYSDKETAKEITKPKNFVEG
ITERKEIFPTIPRLAPPASKINFQRSPSYIELFQGMRVVLDKHDAHYNWKRLASQVSLSE
GLKVNTEEDAAIINKSQDDAKAERMTQISEVIEYEMQQPIPTYLPKAHLDGSGIEKSDDK
FLEIEEELKEELKGSKTGDEDVGNNNPSNSIPKIEKPPAFKVIRTSPVRIIGRTFEDTRK
YENGSPSDISFTYDTHNNDEPDKRLMELKFPSQDEIPDDRFYTPAEEPTAEFPVEELPNT
PRSINVTTSNNKSTGDKSSSGNIDQKPTELLDDLEFSSFNIAFGNTSMSTDNMKISSDLS
SNKTVLGNAQKVQESPSGPLIYVLPQSSTRHEKEGFLRKKQKDEPIWVSPSKIDFADLSR
RTKALTPERNTVPLKNNDSRKYKYTGEGSIGNMTNMLLTKDASYAYLKDFVALSDDEDED
GKQNCAVGGPEKLKFY
Download sequence
Identical sequences B3LU62 C8Z472
YCL014W SCRT_05390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]