SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_05447 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_05447
Domain Number 1 Region: 5-113
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.84e-17
Family Ankyrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_05447
Sequence length 222
Comment | SCRG_05446 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (223 aa)
Sequence
MNANIWVAASDGNLDRVEHILHESKGAMSPQSKDINGYTPMHAAAAYGHLDLLKKMCNEY
NGDINVLDNDGDTPLHHVEDVATARLIVEELGGDFTIRNVEGQTPYDSFVENGEDGELIE
YMRIKSGVADVHGVDGVQGEGVIDSKLLEEFKDNVRYTLENDPEEGADEATLQRRRQLEQ
IITGDNAEEELERYIRAMVREQMLGQGSMAGSGDEPDSKRRK
Download sequence
Identical sequences B3LUB4
SCRT_05447 YCR051W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]