SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_05483 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_05483
Domain Number 1 Region: 1-72,132-191
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.00000000000000536
Family Dual specificity phosphatase-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_05483
Sequence length 362
Comment | SCRG_05482 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (363 aa)
Sequence
MLVPPANFGIAEEGIYRCSKVETLNLSFLETLNLKTAIFIGGQEPSKFFKDFFTRSSIKW
IVLRMSDFSAAAVPVKSSSVSNANLYSNNNSTLSLQEEKKKSTANGSQNSTTGDPVIQEE
LAYHLTDNDDLMLIKSTCLKRTFKTLLNVDNYNVLLVDKTALVIGILRKIQKWNIASIIN
EYRLFSGKNRNYFAETFLEIINIEIEQEKDNKTIVDNKAKKLPLENNRTHSIEYKANSGK
LIRVNEDDLCREPEVPQRLLTLINQIETKVKNNKVLQVSGVLGDDLKKTSSDLGIFGHRY
RLAFNKKENGDYGYYKARGKDNVKIRIPCDSELPDWFRFQRDLWEKENVPEEHHFYREHI
FT
Download sequence
Identical sequences A0A0L8VUK7 B3LUE7 B5VF25 C8Z4I1 E7Q1H9 H0GDA4 P25366
YCR095C SCRT_05483 YCR095C YCR095C YCR095C YCR095C YCR095C YCR095C YCR095C YCR095C 4932.YCR095C YCR095C YCR095C YCR095C NP_010019.1.97178 XP_015331481.1.40921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]