SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_05576 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_05576
Domain Number 1 Region: 7-159
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.77e-51
Family Dual specificity phosphatase-like 0.00026
Further Details:      
 
Domain Number 2 Region: 167-329
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.39e-41
Family Dual specificity phosphatase-like 0.0000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_05576
Sequence length 551
Comment | SCRG_05575 | Saccharomyces cerevisiae RM11-1a protein phosphatase (552 aa)
Sequence
MRRSVYLDNTIEFLRGRVYLGAYDYTPEDTDELVFFTVEDAIFYNSFHLDFGPMNIGHLY
RFAVIFHEILNDPENANKAVVFYSSASTRQRANAACMLCCYMILVQAWTPHQVLQPLAQV
DPPFMPFRDAGYSNADFEITIQDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNV
LTPDFIAFASPQEDHPKGYLATKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFE
DIGIQHLDLIFEDGTCPDLSIVKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIY
TYGFTANECIGFLRFIRPGMVVGPQQHWLYLHQNDFREWKYTTRISLKPSEAIGGLYPLI
SLEEYRLQKKKLKDDKRVAQNNIEGELRDLTMTPPSNGHGALSARNTSQPSTANNGSNSF
KSSAVPQTSPGQPRKGQNGSNTIEDINNNRNPTSHANRKVVIESNNSDDESMQDTNGTSN
HYPKVSRKKNDISSASSSRMEDNEPSATNINNAADDTILRQLLPKNRRVTSGRRTTSAAG
GIRKISGTIKK
Download sequence
Identical sequences A0A0L8VRZ3 B3LUN6
YFR028C SCRT_05576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]