SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_00413 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_00413
Domain Number 1 Region: 1029-1098,1191-1225
Classification Level Classification E-value
Superfamily PH domain-like 0.0000576
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_00413
Sequence length 1245
Comment | SCRG_00413 | Saccharomyces cerevisiae RM11-1a sporulation-specific protein 71 (1246 aa)
Sequence
MDSIVNVVEDDVKYAQRVTSFSSPQNANVKVFTIPRHSFTAFRLSYVSPTELSACSQVTL
LGGIPKQWYADQNNQVWKLLTKISLRKVRKQSDMLRRYGYGTIYKKRVGKIPTALYLRKH
FTWSYEDNTSIHNGHRLKEAEMEMKRTRSSPVQKSEYKLSLPRRCKSSSDQNFMRQELLK
EKKSELSRNNSLPLIDTAQAVDIHPVLHEEDQENTNKRNKSLLSNLKRKDLGESKSISRK
DYSHFDRIPSPSSARSVGETDFNYNREPSEDTLRYPDSIIEVTNRTSPAPNSILSRSGQF
VNSNDLSDGFSTSNTINNVGLNANEKIFFNALQSMEKENLMLWKTSQKYGTYLDERRKSA
DAFQKRERGSCVDIGKLHSSHLPFINILPPWPTELTEEERIIHDRLASKHSHHIRKHVHN
ARNKTSCKIKDSVGTFLGMTNSLTNKATVKKRTGQILKKEKMLVMVKEAIQNKVPLPNFS
ENECFDTRVSERWKEYIVIARSTGRFDPPILLQFYRHRHIPEIEDISSIATKYHRNPLDF
FLSRNCIVKFYSSLDKTISIQKPDKRLGGFIDESIEKKDELKHYSPIKIFILRCSSIRSS
GRWYKFLLESLDRQLFTPAINLKIPLTEISIKINLNEIIFQKLIDLGKQEKDRLKICFLQ
RGYKIFQHPILRYFTVAILEKLKLAHYDYLIRKWDTENPVLGCALKRYDRLEWIPCDEDS
LVTGIFAFCQSHLIQYRPIANRLRETKSLEGKCLKEPTPIEGFLIRLTDKYGSARTNFGK
YSISTAYFFTCENLLFSMKAYRANPPLPIDSMIDDTSTEIEKEEIWKQWKKIPEVYEQQP
YPLDTNDHIEWMNCQTTQSEYDSRDFYAFHCFHRRIDQILKTDNVIDLTEVKDIYQGTRT
DYEADKIKYGVYKEASEIFWHRNYEIDDVSRSVINIETSNGLLLKLLATSATVAEEWVIK
LKQMISYWKNKQREDTERLLKIRRSNAGLLMLNGEEETKIGENTLRWIVEHGRADEQTFN
ANGISLSRPLIQKGPLYQKPHKHSVFSKYYVVLISGFIVLFHCFHRSTTGFAKEVLEYAH
YVTIPIDDCYLYSGTTTELDLLQRDRTFDEINYGSHALPRVYGDGWRSVEDESSRCFTLW
FGTRRALSSNRLQKKGNEKQYTQDYGRQDNNIDPPSAPEADLNNSNVPSNTDKIHFTKKL
GVSGKSMVFMARSRQERDLWVMSIYYELERLRRTASTSNSRNQTM
Download sequence
Identical sequences B3LGH1
YDR104C SCRT_00413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]