SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_00875 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_00875
Domain Number 1 Region: 9-98,131-334
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.56e-26
Family SCOPe 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_00875
Sequence length 707
Comment | SCRG_00875 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (708 aa)
Sequence
MVLKSTSANDVSVYQVSGTNVSRSLPDWIAKKRKRQLKNDLEYQNRVELIQDFEFSEASN
KIKVSRDGQYCMATGTYKPQIHVYDFANLSLKFDRHTDAENVDFTILSDDWTKSVHLQND
RSIQFQNKGGLHYTTRIPKFGRSLVYNKVNCDLYVGASGNELYRLNLEKGRFLNPFKLDT
EGVNHVSINEVNGLLAAGTETNVVEFWDPRSRSRVSKLYLENNIDNRPFQVTTTSFRNDG
LTFACGTSNGYSYIYDLRTSEPSIIKDQGYGFDIKKIIWLDNVGTENKIVTCDKRIAKIW
DRLDGKAYASMEPSVDINDIEHVPGTGMFFTANESIPMHTYYIPSLGPSPRWCSFLDSIT
EELEEKPSDTVYSNYRFITRDDVKKLNLTHLVGSRVLRAYMHGFFINTELYDKVSLIANP
DAYKDEREREIRRRIEKERESRIRSSGAVQKPKIKVNKTLVDKLSQKRGDKVAGKVLTDD
RFKEMFEDEEFQVDEDDYDFKQLNPVKSIKETEEGAAKRIRALTAAEESDEERIAMKDGR
GHYDYEDEESDEEESDDETNQKSNKEELSEKDLRKMEKQKALIERRKKEKEQSERFMNEM
KAGTSTSTQRDESAHVTFGEQVGELLEVENGKKSNESILRRNQRGEAELTFIPQRKSKKD
GNYKSRRHDNSSDEEGIDENGNKKDNGRSKPRFENRRRASKNAFRGM
Download sequence
Identical sequences A6ZUF7 B3LI85 C7GSX7 E7KCK9 N1P5Y2 P48234
YGR145W NP_011661.2.97178 YGR145W YGR145W YGR145W YGR145W YGR145W 5wlc_LV YGR145W YGR145W YGR145W YGR145W tr|A6ZUF7|A6ZUF7_YEAS7 SCRT_00875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]