SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_00939 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_00939
Domain Number 1 Region: 40-176
Classification Level Classification E-value
Superfamily Prefoldin 1.96e-18
Family Prefoldin 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_00939
Sequence length 199
Comment | SCRG_00939 | Saccharomyces cerevisiae RM11-1a hypothetical protein similar to Pac10p (200 aa)
Sequence
MDTLFNSTEKNARGIPQAPFIENVNEIIKDPSDFELCFNKFQERLSKYKFMQESKLATIK
QLKTRIPDLENTLKICQSLRNHSDEGDESDEPILLHYQLNDTLYTKAQVDIPEDRADLKV
GLWLGADVMLEYPIDEAIELLKKKLADSEQSLTVSTEDVEFLRENITTMEVNCARLYNWD
VQRRQDLKQAQEGTKNLKI
Download sequence
Identical sequences A0A0L8VQF0 A0A250WCA1 A6ZV60 B3LIE8 C7GXQ7 C8Z8X2 E7KCW0 E7KNP8 E7Q420 G2WEG2 H0GGJ9 N1P270 P48363
YGR078C 4932.YGR078C YGR078C YGR078C YGR078C tr|A6ZV60|A6ZV60_YEAS7 YGR078C YGR078C YGR078C YGR078C NP_011592.3.97178 YGR078C YGR078C YGR078c___KOG3313 355025 YGR078C YGR078C SCRT_00939 YGR078C YGR078C YGR078C YGR078C YGR078C YGR078C YGR078C YGR078C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]