SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_01123 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_01123
Domain Number 1 Region: 12-91
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.64e-16
Family SCOPe 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_01123
Sequence length 283
Comment | SCRG_01123 | Saccharomyces cerevisiae RM11-1a pre-mRNA splicing factor CWC23 (284 aa)
Sequence
MPGHELEDVINQRLNLYDVLELPTPLDVHTIYDDLPQIKRKYRTLALKYHPDKHPDNPSI
IHKFHLLSTATNILTNADVRPHYDRWLIEFLRKTNDIERNKLIQKLEESESSTIPTTTPH
PDLLQIQRHGELLRKLKHFNLPYGDWKHLNTQDQENASQHPYYDCSTLRIVLDNFLQSNN
KSNCLSHLRNQVFITLSANEIYDIYFSERNNYSKDDSIIIYTVFDTPITAQHVFRNWSSG
NLIPTVKDISPLIPLHYYSDFNLETELNDDIARLVSNEPILLD
Download sequence
Identical sequences B3LHI8 C8Z8C2 N1P1Q0 P52868
YGL128C YGL128C 5y88_T APC89506 YGL128C YGL128C SCRT_01123 YGL128C YGL128C YGL128C 4932.YGL128C YGL128C YGL128C YGL128C YGL128C NP_011387.2.97178 YGL128C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]