SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_02659 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_02659
Domain Number 1 Region: 74-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000022
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 164-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000973
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 47-83
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000515
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 120-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000253
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  SCRT_02659
Domain Number - Region: 223-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000202
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 363-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00205
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_02659
Sequence length 429
Comment | SCRG_02659 | Saccharomyces cerevisiae RM11-1a transcription factor IIIA (430 aa)
Sequence
MGGEVLNNEGMPLAELKQETIPISRSESSESLNSLTSTRSSSSNRPKTYFCDYDGCDKAF
TRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTR
QQLKRHEVTHTKSFICPEEGCNLRFYKHPQLRAHILSVHLHKLTCPHCNKSFQRPYRLRN
HISKHHDPEVENPYQCTFAGCCKEFRIWSQLQSHIKNDHPKLKCPICSKPCVGENGLQMH
MIIHDDSLVTKNWKCHICPDMSFSRKHDLLTHYGSIHTEEDIPLELKYKISDIQQLVQDH
GVQLGNSKHSNEQDEEKISNRLRKRRKLTENNNVEFLQNEVDLEKRLESGENGLNLLLNT
VGRKYRCFYNNCSRTFKTKEKYEKHIDKHKVHELKLKILQEKEENKTLVDQNHKEPFIIQ
KETQSAGDK
Download sequence
Identical sequences B3LKE5 B5VTW6 C7GP68 C8ZJL5 E7M1C0 E7QM27 P39933
YPR186C NP_015512.1.97178 XP_015331941.1.40921 4932.YPR186C YPR186C YPR186C SCRT_02659 YPR186C YPR186C YPR186C YPR186C YPR186C YPR186C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]