SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_03500 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_03500
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily Prefoldin 0.00000000000000785
Family Prefoldin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_03500
Sequence length 109
Comment | SCRG_03499 | Saccharomyces cerevisiae RM11-1a prefoldin subunit 1 (110 aa)
Sequence
MSQIAQEMTVSLRNARTQLDMVNQQLAYLDRQEKLAELTKKELESYPTDKVWRSCGKSFI
LQDKSKYVNDLSHDETVLLDQRKTLKIKKNYLETTVEKTIDNLKALMKN
Download sequence
Identical sequences A0A0L8VMH9 A0A250WHR9 A6ZQF5 B3LPU6 C7GS05 C8ZB40 E7KQ41 E7LW64 E7NJ67 G2WGJ6 H0GIH6 N1P8Z6 P46988
YJL179W YJL179W YJL179W YJL179W YJL179W YJL179W YJL179W NP_012356.2.97178 YJL179W YJL179W YJL179W YJL179W YJL179W SCRT_03500 YJL179W YJL179W YJL179W tr|A6ZQF5|A6ZQF5_YEAS7 YJL179W YJL179W YJL179W YJL179W YJL179W YJL179W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]