SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_03893 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  SCRT_03893
Domain Number - Region: 98-162
Classification Level Classification E-value
Superfamily TPR-like 0.00136
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_03893
Sequence length 463
Comment | SCRG_03892 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (464 aa)
Sequence
MWKYLHRSVKNEGTVERLTNLNLFTNHRFKFYSTLKEQSFWRIPFKRRSKLQKWVLSTGI
VSFIAFNIWWVYWPHHTFPKPVAKILRKGLHSEIKKEGANYQKSLEYYLEALEECKAENV
DLLSDEYTGIEIKIGEMYEKLHMYNDATALYGDMLKKFYNELSKTTDKSTKRKFFLLKRD
LQILVRFNEINKDSETNATLLIMHLLLAQREFLENSPEFKNVLSKSELLNNQQLDWKNFK
GLPFIGKSKPDYQMHLNSKRKQELKIKEPESEQCVFMKELLTARDLYTRYCLNRSNLSGA
LNSKITTLEWMLLADSPLDDILLAQAELGSIFYLNSEKFEGSLYAIDNEPYKKSEPLELI
RSRLQENQNSCLQYSADCYKSIISFANENQYPKVAMESEMDQRILKALSLAHYGIGVINL
HKGRLRASKKELKKAIRISEMIRFNELIEEAQRELKKVDGTPI
Download sequence
Identical sequences B3LQW7 C7GVI3 H0GJ17 N1P8C6 P36066
YKL133C NP_012789.2.97178 SCRT_03893 YKL133C YKL133C YKL133C YKL133C YKL133C YKL133C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]