SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_03999 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_03999
Domain Number 1 Region: 699-782
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.31e-20
Family Ankyrin repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 503-585,618-640
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000103
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_03999
Sequence length 1082
Comment | SCRG_03998 | Saccharomyces cerevisiae RM11-1a protein SPT23 (1083 aa)
Sequence
MMSGTGNVSSMLHSYSANIQHNDGSPDLDLLESELLDIALLNSGSSLQDPGLLSLNQEKM
ITAATTTPGKEDEGELRDDIASLQGLLDRHVQFGRKLPLRTPYANPLDFININPQSLPLS
LEIIGLPKVSRVETQMKLSFRIRNAHARKNFFIHLPSDCIAKDKFFTSSDDPTNLTIPNR
DINERTLFLDAFLLCASNNNSNNFKQTYVCNRCINREKRRASRRKSGLNDNSIWQNNENK
RAIIFNSKQLFIISNNGLSGNSNCINFDLPTRIVCYCRHHKATNGFVVLFLLRDHNGDIL
AKTITDPIMIMDKKNASNTTTPTSTSNAQVSPMTNDTRSFSSPQSDLNFPSEFPLPSNSK
NFVISTNCMLDSNCNNNNNDNDNKNNIKTNTAMMNNNRHFPSPNSSSEDSNHSFSDIHFS
NNNDNNLHRSLDSWSSTGFNSSSNPALTTLTSDFSATSARHTGKRQRSVNEPFMSTPNTF
SRLPQKFIDSSKDISNHNSVPVALNNKPSIQRVIPAQGSINGGIEVTLLGSKFKQGLIIK
FGENIALSSQCWNESTMVTFLPPSSKPGPVLVTIIDPSETSMRNNSNSSVSTSNSTNDIL
HLNKYTGEKAIFTYVDDTDRQLIELALQIVGLKMNGKLEDARNIAKRIVGSDSSPSNNNA
GLHSQNSSLNSYTNMMRNINDEQLITEVIKSFKRNNNLSTVNLSMCDVRGRTLLHLAAFN
NWYSLVSLLIKYGSHLNDQDLFGFTPLHMACINGDLRIIRLLLECNVNIMKKTRNGFIAK
QFFLMNYTVNKTRYSNYETSLFDDILTRLTKNTTGSSDTQPFERNVSQSSFNSSLFDDDD
ADHDYVQERKYLLADSAALAPEQSNCNDNTSFSILDSDSGYDISDCESSSDEIALEFFNT
HKIKDFSSKPNEIPKTTKTSIEPDGSLWNRMLTRLNDELPKYEDLFPKKPKNWELGSKSV
EIGPDNSAQMTVDDSQTSSEDDELEALQVGFNTIFSKKQNFQNDKMLLFFWIPLTLVLLL
CFTLSNLGKDGDMFHNLSKIVQEYLRIGLAKVLLGNERMKTSFKMQLSNFQNNNILNDMR
VN
Download sequence
Identical sequences B3LR64
SCRT_03999 YKL020C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]