SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_04092 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_04092
Domain Number 1 Region: 194-352
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.85e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.03
Further Details:      
 
Domain Number 2 Region: 29-82,151-183
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000432
Family Glutathione S-transferase (GST), N-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_04092
Sequence length 370
Comment | SCRG_04091 | Saccharomyces cerevisiae RM11-1a extracellular matrix protein 4 (371 aa)
Sequence
MSKQWASGTNGAFKRQVSSFRETISKQHPIYKPAKGRYWLYVSLACPWAHRTLITRALKG
LTSVIGCSVVHWHLDEKGWRFLDMEKQLEDSEDFLEHWHDVAGGIRTAKEDSSKSFAEIK
NDSQRFMVDATNEPHYGYKRISDLYYKSDPQYSARFTVPVLWDLETQTIVNNESSEIIRI
LNSSAFDEFVDDDHKKTDLVPAQLKTQIDDFNSWVYDSINNGVYKTGFAEKAEVYESEVN
NVFEHLDKVEKILSDKYSKLKAKYGEEDRQKILGEFFTVGDQLTEADIRLYTTVIRFDPV
YVQHFKCNFTSIRAGYPFIHLWVRNLYWNYDAFRYTTDFDHIKLHYTRSHTRINPLGITP
LGPKPDIRPL
Download sequence
Identical sequences A0A0L8VLX5 A7A035 B3LRF0 C7GXD4 C8ZCN7 E7QHJ3 G2WIA3 H0GJP6 P36156
YKR076W YKR076W YKR076W YKR076W YKR076W SCRT_04092 YKR076W YKR076W YKR076W YKR076W YKR076W 4932.YKR076W NP_013002.3.97178 YKR076W YKR076W YKR076W YKR076W tr|A7A035|A7A035_YEAS7 YKR076W YKR076W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]