SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_04591 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_04591
Domain Number 1 Region: 768-886
Classification Level Classification E-value
Superfamily PH domain-like 9.31e-23
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 2 Region: 44-105
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000236
Family SH3-domain 0.0023
Further Details:      
 
Domain Number 3 Region: 259-330
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000102
Family SAM (sterile alpha motif) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_04591
Sequence length 1040
Comment | SCRG_04590 | Saccharomyces cerevisiae RM11-1a protein BOI2 (1041 aa)
Sequence
MSNDREVPTLSQLNTTVSRDKDVSDTLSPDFDSKGSATGRDGGNFPMYIAINEYFKRMED
ELDMKPGDKIKVLTDDEEYKDGWYFGRNLRTNEEGLYPVVFTQKITVEKAPTLMRAKSTK
RIYSPLTNEDPLLSSTFISEKDSNSELPTPQPIETAASISRTANGKIERNLSLKNTMSDI
DNALLEFKDDSIGPPDRFINSGRDEEHSITHETILSATDGLDVVESNSKPTTSSSTGFLN
GDLENQATLINGIDTTKLNPVEAEFWSPEEITAYFIMEGYDVQSASRFQKHKISGKILLE
LELVHLKELDINSFGTRFEIFKEIEKIKEAIRTNGRSLNRASKTNNANIYNQLMPPANVD
QRASYRGHVRKTSQSLEDLPSQQNFIPTPRNTRNSSASKHRPKSLLFDSQEANANIAPDV
QIPQVVEEMAGNENLFVSPRRAPKPPSYPSPAQPPKSPLLNNTRTSPSPTQLYSWQSPTL
SFSGPKRTSYIDQYSSSDSNFNSRSALPKNNQGGGKALSPIPSPTRNSVRNEDSEGKLTS
SSKRNSVPYYGYAPESSSDRKSSCSSHEEEQFQETMNTFERPTSSIYADGSTIASISNEK
LAHEKEGKKKPTRHSSSLSSKSKSDSRRNSSLKRSSSASRTSSFKKSSFMLSPFRQQFTD
NAARSSSPEENPITSMPSEKNSSPIVDKKSSKKSRSKRRSVSAKEAEIFTETVKDDKNKR
SASEAIKGETLKGKSLRQMTARPVAKKKQTSAFIEGLRSISVKEAMKDADFSGWMSKKGS
GAMSTWKTRFFTLHGTRLSYFSSTTDTRERGLIDITAHRVVPAKEDDKLVSLYAASTGKG
RYCFKLLPPQPGSKKGLTFTQPRTHYFAVDNKEEMRGWMAALIKTTIDIDTSVPIISSYT
TPTVSLSKAQEMLAEAREETKLREQQMLENEEDEDQFLWDQQQLQQQQHDNNQGQADRTI
SASTQRTSDEDNTISTPNLSSANNTTIGSNGFSSPFLLASGLLSPGVARNSSMRGTEKKG
KFSTEEDYFRDNSKHKTDKI
Download sequence
Identical sequences B3LRN0
YER114C SCRT_04591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]