SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_04744 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_04744
Domain Number 1 Region: 83-333
Classification Level Classification E-value
Superfamily vWA-like 9.67e-32
Family Trunk domain of Sec23/24 0.0013
Further Details:      
 
Domain Number 2 Region: 508-627
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 5.23e-20
Family C-terminal, gelsolin-like domain of Sec23/24 0.0035
Further Details:      
 
Domain Number 3 Region: 18-56
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.00000144
Family Zn-finger domain of Sec23/24 0.0058
Further Details:      
 
Weak hits

Sequence:  SCRT_04744
Domain Number - Region: 464-506
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 0.000162
Family Helical domain of Sec23/24 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_04744
Sequence length 630
Comment | SCRG_04743 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (631 aa)
Sequence
MCSPTNFLYEPFSSDAVTQNYDQNLKCTKCGAYYSMACSLREQNVWTCLFCNQSNSNAEL
PLVPSNTYTLTSAKKEILSRRTIMIIDAICDPHELNYLVSILCNNYITRQQEPLSIITIQ
QSGHVILHNAVNHKRDAVFSINEFMTNYNLDELNASYFEKKISEINQESYWFDKSTQGSL
RKLLREICKIANKANISSKRDKRCTGLALFVSSVLASQSSLSAYCHIVSFLNGPCTKGGG
KVMSRERGESMRQNHHFESKSSQLQLSKSSTKFYKKMLEKFANQTLIYEFFIASLDQIGI
LEMSPLITSSMAVSQFDSFNDERFAMSFQKYLNLRDHNAIYNCHSKIMTAKNAIVVKDFP
KYSLNPKNLSLPLEISLGHNSAEAPIQFQTTFENRTEKYIRIETLLLPKANRSFGAQNEI
VFSMKKIASRIIDSFAYSSKHTKELMKQLFLLPNQIRGKDVDMVNLIQWCYHIYRSPILS
VRNTSPDERYLFLHRIINASKDTCLSLCKPFIWSYSDLKHDWIVLDVPLTRAQILQDDKT
TICVDGGSYLVLRRGKLLEKEGRELCCKFLNDLQRFPQPLYVETKTGGSQDRFLKSKIIP
LDITDKETLGTEDMTFNEYFNLFTDLSRSK
Download sequence
Identical sequences A0A0L8VPE8 B3LSF5 E7QFK1
SCRT_04744 YHR035W YHR035W YHR035W YHR035W YHR035W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]