SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_04843 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  SCRT_04843
Domain Number - Region: 149-186,253-296
Classification Level Classification E-value
Superfamily PH domain-like 0.00138
Family Pleckstrin-homology domain (PH domain) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_04843
Sequence length 850
Comment | SCRG_04842 | Saccharomyces cerevisiae RM11-1a PH domain protein (851 aa)
Sequence
MALPIEGKLSMANNRIERLKSPSSSSTCSMDEVLITSSNNSSSICLETMRQLPREGVSGQ
INIIKETAASSSSHAALFIKQDLYEHIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKS
SLPPLYAPAVYELTLISLKLERLSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIR
NYSSGETKSEKEDRIHSDLVHRSDQSQHLHHRLFTLPTRSASEFKKADQERVSYRVKRDR
SRYLTDEALYKSFTLQNARFGIPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLS
IGISVSLDLEVREYPDYRIVPRRRRRRRRRRRRRRHTHRSESSMGSFSQRFIRSNSRPDL
IQRYSTGSSTNNNTTIRERSNTFTAGLLDHYCTGLSKTPTEALISSAASGESSDNSTLGS
TRSLSGCSASRSIASRSLKFKIKNFFRPKNSSRTEKLHRLRSNSSNLNSVIETEEDDEHH
ESSGGDHPEPGVPVNTTIKVERPMHRNRAISMPQRQSLRRAISEEVVPIKFPNSTVGESV
HSPSPIEHLSVDGCEIMLQSQNAVMKEELRSVASNLVANERDEASIRPKPQSSSIYLSGL
APNGESATDLSQSSRSLCLTNRDAEINDDESATETDEDENDGETDEYAGDDTNDDTDDSN
IGYAYGSESDYSCLIEERIRNRRRASSTLSCFSNIPYGTDDIKWKPAIKEISRRRYLRDS
LKCIKPFLDSNDCLGKVIYIPVSGPTFETSNKIHFSNRQSLQKQKNHFLKGFIVGPTALI
ELNCKNKNAIVGTTKDAEDHGEDDGDGDDGEDDDDDDDDDDDDDDDEDDDDDDDDDDDDD
DDDDDGQITA
Download sequence
Identical sequences B3LSP4 E7Q4S6
YHR131C YHR131C SCRT_04843 YHR131C YHR131C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]