SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_117.70 from Carica papaya

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  evm.TU.supercontig_117.70
Domain Number - Region: 74-98
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0706
Family Hairpin loop containing domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_117.70
Sequence length 113
Sequence
MLSDIQLRTRAVALSLYALPSQNRPGGSAVPITKGTNINSNSHYEDQMKSLFSNDDPELL
KPLVPDDPTSSQGAKQCSNGICRSFLWRAGQAICIILGAVVVLVILVVLCSVI
Download sequence
Identical sequences evm.TU.supercontig_117.70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]