SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_119.58 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_119.58
Domain Number 1 Region: 559-788
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-43
Family Protein kinases, catalytic subunit 0.00025
Further Details:      
 
Domain Number 2 Region: 126-199
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.02e-18
Family alpha-D-mannose-specific plant lectins 0.002
Further Details:      
 
Domain Number 3 Region: 204-306
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000144
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_119.58
Sequence length 812
Sequence
MFVTWLIQLKFGVPIQHFQGKSCKFCDFGGYGSVLGVLLLMGYAFCGFCDEFPVVSMPLG
FEISGLDRSRTWVSRNGVFAFGFFKGCQKTEDFDGFVVGIRYNLGDEAANVPVWTVGGGL
RVPVYSTVRLSMDGRLVLFANSSNLIVWSSNTSGLGVQKATLLNDGNLVLTDNSGKVLWG
SFASPTSTLLPGQSLHFSQSLRAPSTKSISSYYNFLIQPSGELAIVWESNVTYWKTHTSS
SGVSREARFDANGVLRLIDVNNKTVWSASSKDSEDPSVVLRHLKIDTDGNLRIYLWNSVL
REWRVGWQAVENQCDVFGSCGLYSLCEFNSTGPLCDCLSDDSNNLGTGLPVPEIGSSRCG
KMADLASCKMNTSMMVFKQTVLYGLYPPQDVVVMLSEEACKEYCSNDATCIAVTSRNDGS
GVCTVKRTSFITGYRKPSIQANSFLKVCLVPQAVSARANLHGNSNQVTMSSKGSINHGGN
GKEFAGAVAITVLVTVLSFLSVQIFMCWFIYRRLKQQAQTRIPFGKDEQMNSHYSAIVRL
SFEEIKDLTSNFAHQLGPSIFKGLLPNKTPVIAKVLNDVVVTEKEFRGVVSMLGGMHHRN
LVHLKGFCFEGKHKYLLYEYVPNGSLDKWLFDTAREHEVGNWQQRLNIAIGVARALAYLH
LECQTCVAHGNLKLENVLLDENMIPKVADFGLRRLLRKDTASSSETPSERDIHMFGEMLL
QIVTCQRNILDTTLQQLVNGNNDELQIELRSESCKEFEEVERAVSIALWCMQSQPFLRPS
ITEVVKVLEGAFSIDRPPLDFRFRQEERVDID
Download sequence
Identical sequences evm.TU.supercontig_119.58

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]