SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_183.6 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_183.6
Domain Number 1 Region: 70-189
Classification Level Classification E-value
Superfamily Lysozyme-like 4.78e-49
Family Family 19 glycosidase 0.00000324
Further Details:      
 
Domain Number 2 Region: 25-65
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.000000000000117
Family Hevein-like agglutinin (lectin) domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_183.6
Sequence length 189
Sequence
MKMRFWSLVFCLLLSPLLGSSSAEQCGQQAGGALCPGGLCCSQYGWCGSTEDYCGDGCQS
QCNPGDLGGVESIISRSTFDQMLKHRNNPACPAKGFYTYDAFIAAAKSFRGFGTTGSTDV
RKREIAAFFGQTSHETTGGWPSAPDGPYAWGYCYLKERNPSSKYCAPSSRYPCAPGKSYY
GRGPIQLSW
Download sequence
Identical sequences evm.TU.supercontig_183.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]