SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_21.140 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_21.140
Domain Number 1 Region: 500-795
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-74
Family Protein kinases, catalytic subunit 0.0000866
Further Details:      
 
Domain Number 2 Region: 62-208
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.28e-24
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_21.140
Domain Number - Region: 212-271
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00406
Family alpha-D-mannose-specific plant lectins 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_21.140
Sequence length 809
Sequence
MEFLCVFSWVLSLLLIFSSSSSAEQYVLRDGSSLSVEKPTDVLLSPNGVFSAGFFRVGVR
AFCFAVWITKSKDPTVVWMANRDEPVNGIGSKLSLQKNGNLILTDGVRRTQWETKTASSS
SVELILLNDGNLVLVTANSEKEKLWQSFDSPTDTLLPEQVLTKDTFLTSSRSISNFSSGN
YRLYFDNDNVLRLLYNVPDTTSVYWPNPAIMPWQSGRSTYNNSRLAVLNLLGNFAASDNF
NCNSSDYGGKILRRLTLDPDGNLRIYSLVSESRTWVVSWQAISQPCTIHGICGDNSVCGY
DHVRGRRCSCLPGYRARSTTNWIQGCEPEFEFSCNSSKFDFKSLPHVQPFGFDRDGFPSA
SLEACKERCLSMCSCRGFVFDYDMTNNNGYLCYPKIRLFNGFITPSFSGNLYLKLPKANM
NSVKKISTESRLECSRDFAVQLNRTYEKARGAWSLNFLLWFAVSVAIFEMTCIFLVWCVL
FRTEKDSDSEAAKQGYIQAATGFKKFTYAQLKKATGSFTEEIGRGGGGVVYRGVLPDNRI
AAIKKLNEANQGEGEFLAEVGTIGRLNHMNLIEMWGYCAEGKHRLLIYEFMEHGSLADNL
SSNSLNWEKRFDIAVGTARGLAYLHEECLEWILHCDIKPQNILLDSDYQPKVADFGLSKL
LNRGGGDMNGSSFSRIRGTRGYMAPEWVYNLPLNSKVDVYSYGIVVLEMVTGKSPIGIHS
LDGGMATEHGRLVPWVREKVNGGATRESWIAELMDPLMANEYNVDKVECLVRVALKCVED
DKDSRPTMSQVVEMLLQNEGKLSKIHSML
Download sequence
Identical sequences evm.TU.supercontig_21.140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]