SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_27.175 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_27.175
Domain Number 1 Region: 80-191
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.27e-17
Family alpha-D-mannose-specific plant lectins 0.0068
Further Details:      
 
Domain Number 2 Region: 292-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000293
Family Follistatin (FS) module N-terminal domain, FS-N 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_27.175
Sequence length 433
Sequence
MVSFVFFLLLFCILVASMKPSSLAMEITDVLSAPHSLSFGNSLVSPSQVFEFGFFTTKNS
SNNFTYLGIWFKNLDRSPKPIWIANRNNPITGMIGTLVVKKDSRVLLYNGCGNQVQDSII
WFINPKRKAISPSLQLLDSGNLVLIDKNGDDPDGLYLWESFDHPTNVFLSGMKLKTGLQR
RITAWKSDDDPSVGDYSFGLEQPETGELVLRNGSDIISRWGLWDEKSFNFSDYSNPIFQP
VFVSNNHLEVYFLFKSTHLMFLINPHGQIQYLKWSKQIKKWETIMSLPNDSCDEYSRCGP
NKNCYITDNGEPECRCLDGFEEKSNGCERKWEVKGCGEGDWFVKVGNVKLPDKGRMMRME
DEEEGCQEACLKNCSCTGYAEVDVGGKGNECVFWAGDLFDLRNYPLGGHDIFVRMAKQQL
GTNFLITLTIYVL
Download sequence
Identical sequences evm.TU.supercontig_27.175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]