SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_37.79 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_37.79
Domain Number 1 Region: 223-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-77
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 71-203
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.59e-19
Family alpha-D-mannose-specific plant lectins 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_37.79
Sequence length 594
Sequence
MDYFLFSSSFFIFLLYFPSFSSSGPLLYSVLPNFTASYFDFIDHSGAFLLSPNGTFKAAI
SNPKPQVHRYYFSVIHSSSNSIIWTAVTTKPMSDSTKLYLTHGGLYIADQSGNPIWSTPE
LDSSVSALELQESGNLVLIDSHNVSLWESFDYPTDTIVEGQRLLVGKSLSSFVSEDNLSL
GDYRFVVTGNNAVLQWNGLSYWKLSMDTNAFKDSNAPASFLAVNRTGLPVRFDYSELATA
TDNFKTKIGSGGFGTVYKGIMPDNSIVAVKKITNVGVEGKKEFCTEIAIIGNVHHINLVK
LKGFCVQGRQRFLVYEYMNRGSLDRTLFDEEPALEWPKRYEIALGTARGLSYLHGGCDHK
IIHCDIKPENILLHENLQVKLTDFGLSKLLNPEQSCHMTTLRGTRGYLAPEWLTSSGISD
RTDVYSYGMVLLEIVRGRRNCSLQTMHQNVENHSSGSELRQVYFPLFALEMHEQGKYLEL
ADSRLEGRVGSKEVEKLVRIALCCVHGEPMLRPTMANVVSMLEGSLPLAEPNIESLNFLR
VYGRRFMEASTTMLEDFNGHNEFILHHQVNDSTRKTSSYNSLPFISSQQLSEPR
Download sequence
Identical sequences evm.TU.supercontig_37.79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]