SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_42.134 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_42.134
Domain Number 1 Region: 493-814
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-78
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 55-131,163-191
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-22
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_42.134
Domain Number - Region: 341-369
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0942
Family Hairpin loop containing domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_42.134
Sequence length 824
Sequence
MLYRCEGTMLSGDYITGNKTLVSPTGAFALGFFSPQDSNKSYVGIWYHDLGPEKTVVWVA
NRDSPLDSPSKFTLRHDNLLILDSTGKIVWSTNITSQHSVNTTVGLLRDDGNLLLQLNEK
TVWESFNTSSDTTLPGKIVSFNKKTNKELVLSSWSNKQDPKPGIFTYGIDPEGITQFLIW
KKSKRYWRSNVYGLSQTESTYDLWKNMDNFLFTLNFIGDEHYMTFELVSPRQVDKARFLL
TSDGQIALFFWLGYEWASIWSAPSRMCDFYGYCGPSGVCDLISQSSSWRVCKCLPGYKPR
NEQEWDRGEWSGGCKVEKDLECDNRDGFSKVKMMKFPDLPIMLGMMNASTCQSRCLQNCS
CSAYGYLDMPNNKVRDDHVEGRNDIITCLNWHGDLLDLVELLSGDDKGRDLYVRIPGSKS
DAVTDGSHENDNHVPIQNKKVVVAISTALIAFLLIAIIALYCLWWRNTSSDREAERNVIG
RSFTSEGRQEDGKLVEFNFKSILLATNNFSDSNKLGEGGFGAVYKGNLPQDRVVAIKRLS
EKSSQGLEEFMNELKLIANLQHKNLVRLIGCCVKNGEKLLVYEYMPNRSLDKFLFDPNEK
RILDWNKRFQIIEGIAQGILYLHKHSRLKVIHRDLKASNILLDGEMNPKISDFEMARIFD
MNQTEAKTNKVVGTYGYMSPEYGLYGKFSEKSDVFSFGVLLIEIVSGKRNINFHCEDLSQ
ILQIWAWKEWKKGKALEIIDSSIRDTCSIQQAERCIHIGLLCVQEAPIDRPIMSSVILML
GNETILLPSPKEPAFWMSNDNTSLHQPFNSHSYNEMTITWSEAR
Download sequence
Identical sequences evm.TU.supercontig_42.134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]