SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_765.1 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_765.1
Domain Number 1 Region: 42-134
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.96e-18
Family Canonical RBD 0.0019
Further Details:      
 
Domain Number 2 Region: 193-257
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000443
Family Canonical RBD 0.0035
Further Details:      
 
Domain Number 3 Region: 145-181
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000173
Family Ran binding protein zinc finger-like 0.0022
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_765.1
Domain Number - Region: 313-384
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00828
Family alpha-D-mannose-specific plant lectins 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_765.1
Sequence length 525
Sequence
MIDLDQGPLEVEVMEEVKERIAMMMIAMKELKSEGIVKRNAPSATVVVKGLSQKTTEEDL
YQILAEWGPLRHVRVIKERNSGISRGFAFIDFPTVGAARAMMDRIGDDGLVVDGKKLCFE
YSSKPTGGTGGSFGQESAGRSGHANHKSIMVPSDWMCIICGCVNFARRTSCFQCNEPRTE
DAPPADMTLSNPASLGKKGSDAGPTHVLVVRGLDENADEEMLRYEFSKHAPIKDLRLVRD
KFTHVSRGFAFVHFHSVCNLCSSGTSGSSHSSSLAAAAIEAAAFSQQYDAVGWAPKEYNP
DDKQSTGGQEQGGAQVSVQKDGSAPQSGFVWDEASGYYYDAASGFYYDGNTGLYYDGNSG
IWYSYDHQSQQYIPCTEQNDKKASVQQNEPSKTDASNNKKVVISAPAATVTSVEKAASLP
DAVQAAAAAAIAAEKKEKEKAKEIKLASKSSILANKKKMNNVLTMWKQRSHEGQATRLAL
DDNPPSVSAEDRSFSVGQSTKNKLKPDMPNAKENTLSSSELLQLL
Download sequence
Identical sequences evm.TU.supercontig_765.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]