SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_97.104 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_97.104
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000484
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_97.104
Domain Number - Region: 243-274
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0051
Family Pan module (APPLE domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_97.104
Sequence length 297
Sequence
MVLHDSKGNFIWQSFDSPTDTLLVGQSLRLGGVTKLVSRASEKVNANGAYSLVLEPKRVA
LYFKSPNSVNPLVYFTSSFISASKNGILANATLTSSPETDENFAWILDFSLKESNTGFGG
GPILARPKYNSTLTFLRLGIDGTVKLFTFYNKVDNGAWEETFTMFKREPSFLWDTECQLP
ERCGSFGVCEDSQCVACPSPNGLLGWSKSCEAKKLTYCRPSDFHYYKIEGVDHFMSKFNK
GDRIKETDCEKKCSRDCKCLGYFYHREDSTCWTANDMLTLTKVSNSSHVGFIKTPNK
Download sequence
Identical sequences evm.TU.supercontig_97.104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]