SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_117.5 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_117.5
Domain Number 1 Region: 75-191
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.32e-23
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Domain Number 2 Region: 172-262
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000118
Family alpha-D-mannose-specific plant lectins 0.0045
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_117.5
Domain Number - Region: 360-436
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00139
Family Protein kinases, catalytic subunit 0.012
Further Details:      
 
Domain Number - Region: 296-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_117.5
Sequence length 445
Sequence
MATVSSCLCLILPFVLLLVPTIAQTHSNVTSGSFLTAKKDGSSWTSPSGEFAFGFQKIGT
GFLLAIWFDRIPEETIVWSANGKNLVEEGSRVELTRDGEFRLTDTKGKEIWSADLIETGV
SHGAMLDSGNFVLVNQESVTLWESFDQPTDTILPMQTFNLGGKLFARFSETNYSRGRFMF
TLQQDGNLLLSTTQFPLDFANSKYWSTDTVGSGFRVMFNQSGSIYLTARNGSILHFISSN
RASTSDFYQRLILEFDGVLRQYIYPKSAGSSGGRLMAWSTLSFQPLDICLSMRQETGSGA
CGFNSYCVMGANERPSCKCPRGYSYLDPDNEMNGCKQDFVSQDCDAGQQEASLKNFDQNA
KEDNLMVLADWVSDNYRGGVLELMIENDEEAIQDIKRVDKFVMIAIWCIQEDPSMRPTMK
KVSQMLEGTVEVPSPPDPSSFISSV
Download sequence
Identical sequences evm.TU.supercontig_117.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]