SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_2.145 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_2.145
Domain Number 1 Region: 457-563,593-780
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-76
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 78-186
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000458
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_2.145
Domain Number - Region: 254-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.027
Family EGF-type module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_2.145
Sequence length 799
Sequence
MSPCYSLPFLFLLLLSNSSPSSAQNPSSYSFSDPPWRPSQNKNLISPNSVFAAGFLPLRN
SKDLYTFSIWVHNISETTEVWSLNDDSPVTADASLDITAGGELRLVNSSGQNLWQPPAAA
TNSTKLQLNDNGNLVYGTWESFHHPTHTFLPNQTMNGTELVSKNGKFMFLDCQDLVFNSS
KYWSSSDKFQKLGSDGKVALENGKTVLSADYGSDNLRLRRVTLDVDGNFRIYSLDPSVGK
WEVVWRATQEICSIHGTCGPNAICMSDPTNDSVSCVCPPGFKRSPADPKACDRKIQLTNN
TRFVRLDYVNYTSDSSRQRVINAQNFTICESKCLADPRCLGFGFKYDGTGYCVLQLDQLL
FGYWSPGTDTAMFLRVDKSETDQTTFTGMTELMETTCPVRISLPIPPEESNTTTRNIVII
CILFAAELITGVVFFWAFLKRYIKYRDMARTLGLEFLPAGGPKRFSYAELKAATNDFSNL
IGRGGFGDVYKGELSDHRAVAVKCLKDVTGGDTEFWAEVNIIARMHHLNLVRLWGFCAEK
GQRILVYEYVSNGSLDKYLFHARRDKPSNKSEADTSSEWEGEMDPVEINNPKPMLDWSIR
YRIALGVARAIAYLHEECLEWVLHCDIKPENILLGDDFCPKISDFGLAKLKKKEDMVSMS
RIRGTRGYMAPEWIKMDPITPKADVYSFGMVLLEIVSGVRNFEIQSSLMDSEDWYFPRWA
FDKVFKESNVEDILDRQIKHCYDSRAHFDLVDRMVKTAMWCLQDRPEMRPSMGKVAKMLE
GTVEITEPKKPTIFFLSDE
Download sequence
Identical sequences evm.TU.supercontig_2.145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]