SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_21.141 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_21.141
Domain Number 1 Region: 496-791
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-75
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 61-206
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.5e-21
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_21.141
Domain Number - Region: 340-385
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0392
Family Anti-platelet protein 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_21.141
Sequence length 809
Sequence
MDLWLLSWVLSFLLVLSLCSSAELSSLRKGSFLSVEKPDDVLISPNGVFSAGFFSVGINA
FCFAVWINESKDRTVVWMANRDEPVNGIGSKLSLLKTGELILTDGVRRTQWTTGTASHSG
VDLLLRNNGNLVLVTSGSEKKDLWQSFDSPTNTLLPEQVLTKDRFLISSRSSTNYSSGYY
RLYFDNDNVLRLLYNIPATTSVYWPDPWLMPWEAGRSTYNNSRVAVLNALGCFASSDDFK
CFSADFGVKILRRLMLDPDGNLRIYSLVGTNKTWVISWQAISQPCKIHGICGGHSMCSYD
HVKGRRCSCLPGYRFRNVADWTRGCEPDFNVNSELDTFDFKRLPHVESFGFDKGGFSKAT
LEECKKTCLNMSSCRGFAFKFGMSSGHQCYPKTRLFNGYISPSFSGDLYVKMPKSELNSV
KEINIDTRLKCSGELVVLDRTYLPARVNWSLRFLLWFASSVAVFEITCVLLVRCFLFRTE
RASESEAVKQGYAYAATGFRRYTYDQLKKATRGFSEEIGRGGGGVVYKGVLPDNQIVAIK
RLNDANQGEGEFLAEVGTIGRLNHMNLIEMWGYCAEGKHRLLVYEFMEHGSVADRLASNS
LNWEKRFSIAVGTAKGLAYLHEECLEWVLHCDIKPQNILLDSDYQPKVADFGLSKLLNRG
GTSMNGSSFSRIRGTRGYMAPEWVYNLPINSKVDVYSYGIVVLEMVTGKSPIGFHSLDGG
GVTEHGRLVPWVREKVNGAATRESWMEETVDPLLADDYNVDRMECLVRVALKCVEEDKDS
RPTMSQVVQMLLQNEGKFLHDPLGAVKKP
Download sequence
Identical sequences evm.TU.supercontig_21.141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]