SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_235.5 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_235.5
Domain Number 1 Region: 135-216
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000321
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 2 Region: 236-266
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000157
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 74-107
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000222
Family CCCH zinc finger 0.0021
Further Details:      
 
Domain Number 4 Region: 10-35
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000615
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_235.5
Sequence length 270
Sequence
MESFPSGIGSKSKPCTKFFSTSGCPFGEGCHFLHYVPGGFKTVSQMLNLGGNAAIPPAPR
NPVVPPSFADGSSPTTVKTRMCNKYNTAEGCKFGDKCHFAHGEWELGKPSGPAYEDPHAM
GPGRMGGRIEPPQGHGAAASFGASATAKISVDASLAGAIIGKNGVNSKQICRVTGAKLSI
REHETDPNLRNIELEGTFDQIKQASAMVRELIVNVSSGSGMSMKNQSMLGSGPSNNFKTK
LCDNFTKGCCTFGDRCHFAHGMEELRKSGM
Download sequence
Identical sequences evm.TU.supercontig_235.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]