SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_27.170 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_27.170
Domain Number 1 Region: 494-788
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-80
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 71-152,184-215
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.89e-28
Family alpha-D-mannose-specific plant lectins 0.0025
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_27.170
Domain Number - Region: 285-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00117
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_27.170
Sequence length 835
Sequence
MEPVKGLLFTWFLFLLFHSSLSIDTIRANLPINDGDLIVSKRERFVLGFFTPGNSNNRYV
GIWYYPVSEQTVVWVANRDNPINDTSGTISIDDHGNLVVYKRNGTLPVWSTNSTLTAKKS
NSVAQLLDSGNLLLLDNLTGEVLWQSFDHPTHCMLPFMKLGLTRTTGMNRFLTSWKSPDD
PGTGNYSYRINPDGFPQLMLYKGSVPIWRTGSWTGQRWSGVPEMTRSYIFNTSFINNPDE
ISITYGVTNDSIITRMVLNETGLQQRFTWNDRVGRWIGFWSAPKEECDFYQHCGPNSNCE
PFPEKFECTCLPGFEPRLPQEWFLRDGSGGCVRNRGASTCRSGEGFVRLSRVKVPDTSFA
RADLNLGLKECEQRCLSNCSCVAFSSAYYESNGGTGCLTWYGNLLDARTYQAAGQDFYVR
VDAAELARWRKNDSLGKKKIIAIVLACVAGICVIAGSGYCLVRRKMREKRRMAEFPFSLT
TGSAYLDDSANELEDSRQNRDLPFFDLATIAKSTNNFSIDNKLGEGGFGSVYKGVLQNGK
EIAVKRLSKHSGQGVEEFKNEITLIAKLQHRNLVRILGCCIEGSEKMLIYEYLPNKSLDS
LIFDKTKGSQLDWNKRFEIICGTARGILYLHQDSRLRIIHRDLKASNVLLDASLNPKISD
FGMARIFGGDQVEGNTKRVVGTYGYMSPEYAMEGLFSIKSDVYSFGVLLLEIISGLKNSS
YYSESRAANLVGHVWDLWKEGRAMEIVDKSLCESSRDMEILRCIQIGLLCVQEHAGDRPT
MSTVVFMLGNDAAALPSPKQPAFILKKIQQGDDVSSSQGAGSSVNEVTLTLVQGR
Download sequence
Identical sequences evm.TU.supercontig_27.170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]