SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_27.176 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_27.176
Domain Number 1 Region: 505-801
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-84
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 77-191
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.84e-24
Family alpha-D-mannose-specific plant lectins 0.006
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_27.176
Domain Number - Region: 351-413
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.018
Family Anti-platelet protein 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_27.176
Sequence length 850
Sequence
MSHHYHHCCTFFFIFFSLFIFFPSLSISLKTLTSHQPLTTNQTLISAGDVFELGFFTLPG
ELWYVGIWYRNIPQRTIVWVANRDNPLTTNPSAAALTISNNCIVLLDQEQALVWSSNQTK
VDGQLDDKTLLVELLDNGNLVLREENNDDPEEFLWQSFDFPTDTLLPEMKLGWDLDSGFH
GLTSWKHTDDPSSGDYTYKLNFHGFPEFFISNEQKRTYRSGPWNGLRFSGVPEMNPQSQI
AFKFVSTDNKIFYSYTLVNKSLHSRLVVNPYGNLERYTWIENIQAWRLFWFAPKDQCDKY
RECGPFGICNPNSSPVCKCFRGFRPRNPETWKLRDGSGGCVRETELECLSDKFLHVKNMK
LPESGKAVVKREMGIKECEKECLKNCSCVAFSSSDISNGGASGCVMWSGELLDTREYADR
GQDLFVRLAASDIGDDGYARDLIIGIVVGVGILLVGVVTWFLWKRKKVLNKRKLAKTKTK
GTLERSEDCLINEMVIANKKEYSTSESNEDELELPLIDFNTLQMATDNFSDVNKLGRGGF
GCVYKGKLIEGQEIAVKRLSKKSGQGSEEFKNEVRLIARLQHRNLVRLLGCCIETDERML
IYEYMENRSLDSILFNKARSSLLNWQQRYNIICGIARGLLYLHQDSRFRIIHRDMKASNI
LLDRDMNPKISDFGMARIFGGDQTEGRTQRIVGTYGYMSPEYTINGIFSTKSDIYSFGVL
VLEIVSGKRNWGFYQPDKELNLLGQIWELWREGKGLEIIDSSMGEDSYSINEVLRCIQVG
LLCVQERAEDRPTMASVVLMLSSENPTMANPKTPGFILGRSPAETNSSSSNNCDKMCSVN
QVTVTELNAR
Download sequence
Identical sequences evm.TU.supercontig_27.176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]