SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_27.178 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_27.178
Domain Number 1 Region: 482-752
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-66
Family Protein kinases, catalytic subunit 0.00051
Further Details:      
 
Domain Number 2 Region: 76-182
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.44e-27
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_27.178
Domain Number - Region: 43-116,227-273
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.00209
Family Tricorn protease N-terminal domain 0.035
Further Details:      
 
Domain Number - Region: 348-410
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00341
Family Anti-platelet protein 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_27.178
Sequence length 774
Sequence
MNARSSLISFLLSGLLDCVLIKFCVAFDTITPIQFISDTESIISSQGSFRLGFFSPDNST
CRYAGIWYNDLPGRTVIWVANRNKPLQDSSGSMKISEDGNLVILNGKNEILWSSNISNPV
KNSSAQLLDTGNLVLKDDSSGITLWESFQHPSNTATSMMKLSTNPRTGEKMKIASWKSHS
DPSDGMFSAGINVVSAPEFFVWNGSRPFWRSGPWNGQIFTGVPEMSSSYGNGFKLVDEEG
TFYLSYTFSNTSLVTNFVLSSEGNLVQTFWEEGKNNWEQVWMAPRTECELYGKCGEFGYC
DKERICSCLKGFEPKNPEEWKRGNWTGGCVRKKSLQCNRNNGGKASQEDGFEKLENVKVP
DFVQWSFRLEDECKDHCLSNCSCVAYAYDSGIGCMLWTGALIDIQILLSDGIDLHIRLHH
SELDKKEDYGALIITAAILGTVAISICTFFLWRWMVKHRGGRSKLLSIDSLGYNKNQIRV
QELPLFNFEILAAATNYFSPSNKLGQGGFGPVYKGKLQDGQEVAVKRLSNLVYEYMPNRS
LDAILFDPTERKGLNWRKRLNIIEGIGRGLLYLHRDSRLRIIHRDLKASNILLDEELNPK
ISDFGMARIFGGKEDQANTRRVVGTYGYMSPEYAMEGQFSEKSDVFSFGVLLLEIISGRR
NSSFYSDKQFLNLLSYAWKLWKEENIVEFIDAVMFEPRFKEEMLRCVHVGLLCVQEFAKD
RPSVSTVISMLKSEIVDLPNPKQPAFTERQILNNTNSSPMNSTNKITITVLEGR
Download sequence
Identical sequences evm.TU.supercontig_27.178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]