SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_27.184 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_27.184
Domain Number 1 Region: 481-789
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-82
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 75-153,184-215
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.97e-28
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_27.184
Domain Number - Region: 350-411
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0102
Family Anti-platelet protein 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_27.184
Sequence length 811
Sequence
MNARSSLISFLLSGLLGCFLLKFCAAFDTITPIQFISDTESIISSQGSFRLGFFSPDNST
RRYAGIWYNDLPGRTVIWVANRNKPLQDSSGSMKISDDGNLVILTGKNEILWSSNISNPV
KNSCAQLLDTGNLVLKDDSSGVTLWESFQHPSNTVTSKMRLSTNPRTGKTVKISSWKSPD
PSDGMFSAGIDVVSAPEFFIWNGSRPFWRSGPWNGLIFTEVTDISSSYGNGFKLVDEEGT
FYLSYTFSNTSLVTKFVLSSEGNLVQTFWEERKNNWEHVWMVPSTECELYGKCGEFGYCD
KERICSCLKGFEPKNPEEWKRGNWTGGCVRKKSLQCNRNNGGKASQEDGFDKLANVKVPD
FVQWSFRLEDECKDYCFSNCSCVAYAYNSGIGCMLWTGTLIDVQILLSDGIDLHIRLHYS
ELDKKEDSGALIITAAILGTVAISICTFFLRRWMVKHRGGSTKLLSIDLLGHNKNQIRVQ
ELPLFNFEILAAATNNFNPSNKLGQGGFGPVYKGKLQDGQEVAVKRLSSNSGQGLEEFRN
EVVVISKLQHRNLVRLFGCCVEGEENILVYEYMPNRSLDAILFDPIERKCLNWRKRLNII
EGIGRGLLYLHRDSRLRIIHRDLKASNILLDEELNPKISDFGMARIFGGKEDRANTRRVV
GTYGYMSPEYAMEGQFSEKSDVFSFGVLLLEIISGRRNSSFYSDKQFLNLLSYAWKLWKE
ENIVEFIDAVMFEPRFKEEMLRCVHVGLLCVQEFAKDRPSVSTVISMLKSEIVDLPNPKQ
PAFTERQILNNTNSSPMNSTNKITITVLEGR
Download sequence
Identical sequences evm.TU.supercontig_27.184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]