SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_50.57 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_50.57
Domain Number 1 Region: 103-179,206-230
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-24
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Domain Number 2 Region: 406-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.53e-19
Family Protein kinases, catalytic subunit 0.0051
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_50.57
Domain Number - Region: 309-356
Classification Level Classification E-value
Superfamily Ganglioside M2 (gm2) activator 0.0902
Family Ganglioside M2 (gm2) activator 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_50.57
Sequence length 567
Sequence
MSSCRVLLFYLLLIHFAYIVASQPFDYPTAKLSTLWTNSLSANHSVTFTDGSTVRAILLR
GSFGPKFACGFFCNGDCETYLFAIFIVQTNSGSGIVLPNLGFPRVVWSPNRNNPVRINST
LELTGDGDLVLRDADGSKVWSTGTAGKSVGGLNLTEMGNLVLFDEKNGTVWDSFDHPTDV
LVPGQMLIEGKNLTASVSSTNWTVGGIYSLSVTWEGLFALFIEADPPLAYFENKVSGNKT
SKEPSYAKFLNGSLALFILSSEPNDSDDAISVPPASSLQYMKLESDGHLRVYEWISSSGW
TQVADLLTGFLGDCSYPSVCGKYGLCTNGQCGCPAPINGGTTYFSQIDFKQPTLGCSEVT
PLSCEAVEDQSFVELEDVTYFTFDWSNRPANPESCKQACLQNCSCKAALFRGTPGYLAPE
WLSSFITEKVDVYSFGVVVLETLCGRRNLDRFQPEEAMHLLSVFEKKVKEGELLDLVDKM
SEDMQFNGAQAVEMMKVAVWCLQRDFARRPSMSMVVKVLEGVMDVEGELDYNLCSAELPK
DIKELAYQHVQPGDATPLLPSVLSGPR
Download sequence
Identical sequences evm.TU.supercontig_50.57

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]