SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_97.103 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_97.103
Domain Number 1 Region: 73-167,195-212
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.94e-29
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_97.103
Domain Number - Region: 391-421
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.011
Family Pan module (APPLE domain) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_97.103
Sequence length 444
Sequence
MASSSSSLAPSFLFVFLVAAFSCIAQSAVPPSETFRFVNEGEFGPFIVEYDGNYRVLSIF
NSPFQLAFYNTTPNAYTLALRMATTRSESLFRWVWEANRGRPVGENATFSLGTDGNLVLA
DADGTIAWQTNTANKGVVGFKLLSNGNMVLHDSKGNFIWQSFDSPTDTLLVGQSLRVGGV
TKLVSRASEKVNANGAYSLVLEPKRVALYFKSPNSAKSLVYFTSSFISASKNGILANATL
TSSPETDENFAWVLNFDLKESNTDFGGGVILARPKYNSTLTFLRLGIDGNVKLFTFYDKV
DNGACEETFTMFKREPSFLWDTECQLPERCGSFGVCEDSQCVACPSPNGLLGWSKSCEAK
KLTYCRPSDFHYYKIEGVDHFMSKFNKGDRIKEADCEKKCSRDCKCLGYFYHREDSRCWT
ANDLLTLTKVSNSSHVGFIKTPNK
Download sequence
Identical sequences evm.TU.supercontig_97.103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]