SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_97.105 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_97.105
Domain Number 1 Region: 84-178,206-223
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.11e-29
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_97.105
Domain Number - Region: 402-432
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0118
Family Pan module (APPLE domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_97.105
Sequence length 455
Sequence
MSSSSSSSSSSSSSSSSSLAGSFLFLLFLSAFSCIAQSVVPPSETFRFVNEGEFGPFIVE
YDGNYRVLSIGTAPFQLAFYNTTPNAYTLALRMATTRSESLFRWVWEANRGRPVGENATF
SLGTDGNLVLADADGTIAWQTNTANKGVVGFKLLSNGNMVLHDSKGNFIWQSFDSPTDTL
LVGQSLRLGGVTKLVSRASEKVNANGAYSLVLEPKRVALYFKSPNSFNPLVYFTSSFISA
SKNGILANATLTSSPETDENFAWILDFSLKESNTGFGGGPILARPKYNSTLTFLRLGIDG
TVKLFTFYNKVDNGAWEETFTMFKREPSFLWDTECQLPERCGSFGVCEDSQCVACPSPNG
LLGWSKNCEAKKLASCKPSDFHYYKIEGVDHFMSKFNKGDKVKEADCEKKCSRDCKCLGY
FYHREVSRCWIANDLLTLTKVSNSSHVGFIKTPNK
Download sequence
Identical sequences evm.TU.supercontig_97.105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]